<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19296
| Description |
Uncharacterized protein |
| Sequence | MQFSQPMGHQQFQGRQLPSGHVQHGIGQGQLNQGSQINRLSQFSSAANSALFNAAQTTANPQMVRFMFHSIVLLSKLLHYLFCLLILLQNVILKLYEILNCLIELDNYPWEGENY |
| Length | 115 |
| Position | Head |
| Organism | Parasponia andersonii (Sponia andersonii) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Parasponia.
|
| Aromaticity | 0.10 |
| Grand average of hydropathy | -0.030 |
| Instability index | 37.67 |
| Isoelectric point | 6.95 |
| Molecular weight | 13091.91 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | integral component of membrane GO:0016021 IEA:UniProtKB-KW
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19296
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 48.11| 14| 15| 76| 90| 1
---------------------------------------------------------------------------
76- 90 (22.19/14.21) KLLHYLFClLILLQN
94- 107 (25.92/12.74) KLYEILNC.LIELDN
---------------------------------------------------------------------------
|