<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19293
| Description |
Mediator of RNA polymerase II transcription subunit |
| Sequence | MDDMVDTLDNAYQEFVGAAANVLEAKESSVAQKTLSTDAALENFKQRWELFRVACDQAEEFVESVKQRIGSECLVDEATGSVAGKSGGSGNTSAAAATGLPPISAVRLEQMSKAVRWLVIELQHGSGSSSGSAAHSHPSAAPFDARFTEDSAQ |
| Length | 153 |
| Position | Tail |
| Organism | Parasponia andersonii (Sponia andersonii) |
| Kingdom | Viridiplantae |
| Lineage | Eukaryota> Viridiplantae> Streptophyta> Embryophyta> Tracheophyta>
Spermatophyta> Magnoliopsida> eudicotyledons> Gunneridae> Pentapetalae>
rosids> fabids> Rosales> Cannabaceae> Parasponia.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.264 |
| Instability index | 50.93 |
| Isoelectric point | 4.63 |
| Molecular weight | 16094.51 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | cold acclimation GO:0009631 IEA:InterPro
leaf senescence GO:0010150 IEA:InterPro
regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
root development GO:0048364 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19293
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.12| 27| 42| 74| 105| 1
---------------------------------------------------------------------------
74- 105 (37.18/30.17) LVDE.ATGSvaGKSGGSGNTSAAAATglpPISA
118- 145 (45.94/23.40) LVIElQHGS..GSSSGSAAHSHPSAA...PFDA
---------------------------------------------------------------------------
|