<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19281

Description Mediator of RNA polymerase II transcription subunit 5
SequenceMEGRIPLSEAFRESVKYWSSFVSKCLTKRLDASTFEDYVQLVQSKHRLPPEIIADFFIRPMKSNCVSPDPRIPPYVSVLTKLRYTDAVSILRALYRYSSLHALIPEQSQHEGDGANGEGATRQDAQQAPSLRWKSSSWLEEVMFYHVIKLLVEGSAFKDSRTALELIHISSKWMVLFTTASNSMTADMLGGSLQDPQVRHEMETAWGALVPLVLRLVDNAAFVKVVSQPSAKGARKVFSESLASFVQVIQQSPQLPQFQQFINKLELFRTEVLAPLDPVDKSKQAANAVMDDILDSTVGVDNLVIPEVPITNTRAGLYIYLGASLVGRPLIDDHALFSYLNNRYQGDVQQSAVDLILASFDLLANAVFRNEGPRDAQLLRSFLINKVPLILAQLCPPGFATPSAEFCITQALPHVDTSVFPTASLMFDESRNNNPYTESVREEFCSACALHGLIEREHVERILGESSMGYEPSQEKYSKEKLVQSCLSDPEKIQALIRDMDKMDGNVGAVCQALVELLRQLCHSKETMSLKLLCSQLAQKPQSLDILLLFEKLPTILEPICQLLDSWRYEEDQGEYQPVYEEFGAILLLVLAFAYRYSLTPADIGIISPDSNVAKIIGRAHISRELGELSEQENGHVGGWIQGLFDSDAGGLGDDLMSSCPPADFYLLIATLFQNIVIAYTQGFLTDDALRSGVEYLIDTFLLPSLIPAIRFLSDYLWVEQKEQKSIIKILQLILLPTSISGEATTMLASVKGIVAKPLEHSLRSYQRQDPKNQDIEPLLRVLKDSLPFSRRTGAAEHQELELWATSSSSGLSGAAKHLIQGLVQWCVHTDETAMPTSYTHRQVIATLKIVGASRLLRVILEEIRHQTLAGNGSVVYDVATALICAPNVSNELPPTSGLLDETGNMLPILQRPLTLREVLKMEAEDYRKLQKKDAELAEIVVRLHRRVEAQMVLPPPPMLQAADMQLDLAGDATNLEDSIVVAAGVPGDATMSMDGVGSLDMGLGGISSDLGLGGPGSNGGLDASAEADLFGSLDDTDMDVFDGWGGMDLGGP
Length1053
PositionTail
OrganismTrichoderma gamsii
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
Aromaticity0.07
Grand average of hydropathy-0.036
Instability index44.99
Isoelectric point4.89
Molecular weight115890.26
Publications
PubMed=26893428

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP19281
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      86.90|      25|      32|     118|     144|       1
---------------------------------------------------------------------------
  118-  144 (42.33/39.87)	EGATRQDAQQAPSLRWKSSSWLeeVMF
  153-  177 (44.57/34.28)	EGSAFKDSRTALELIHISSKWM..VLF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      94.21|      28|      37|     985|    1016|       2
---------------------------------------------------------------------------
  985- 1016 (51.70/39.01)	GVPG..DATMSMDGVGSL...DM....GLGGissdLGLGGP
 1017- 1053 (42.51/23.30)	GSNGglDASAEADLFGSLddtDMdvfdGWGG....MDLGGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      34.04|       9|      37|     405|     414|       3
---------------------------------------------------------------------------
  405-  414 (14.40/13.32)	EFCITQALpH
  443-  451 (19.64/11.63)	EFCSACAL.H
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     141.39|      45|      49|     473|     519|       4
---------------------------------------------------------------------------
  473-  519 (65.78/43.19)	SQEKYSKEKLVQSCLSDPEKIQALIRdMDKMDGNVGAVCQaLVELLR
  524-  568 (75.61/41.62)	SKETMSLKLLCSQLAQKPQSLDILLL.FEKLPTILEPICQ.LLDSWR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.06|      27|      51|     230|     256|       5
---------------------------------------------------------------------------
  230-  256 (45.73/34.10)	SAKGARKVFSESLASFVQVIQQS.PQLP
  282-  309 (39.32/28.18)	SKQAANAVMDDILDSTVGVDNLViPEVP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      84.02|      28|      31|     651|     680|       6
---------------------------------------------------------------------------
  651-  678 (51.98/35.63)	G.LGDD..............LMSSCPPADF...YLLIATLFQNIVI
  683-  728 (32.04/13.50)	GfLTDDalrsgveylidtflLPSLIPAIRFlsdYLWVEQKEQKSII
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.75|      15|      19|     790|     804|       7
---------------------------------------------------------------------------
  790-  804 (28.65/19.12)	SRRTGAAEH..QELELW
  810-  826 (24.10/14.91)	SGLSGAAKHliQGLVQW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      38.63|      15|      31|     335|     358|       9
---------------------------------------------------------------------------
  335-  358 (19.99/33.21)	ALF............SYLNNRyqgdvqqsaVDLILA
  366-  392 (18.63/ 9.43)	AVFrnegprdaqllrSFLINK.........VPLILA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.17|      29|      37|     910|     942|      10
---------------------------------------------------------------------------
  910-  942 (42.05/38.45)	LQRPLTLREVLkmeaEDYRKLQKKDA..ELAE........IVV
  944-  982 (40.12/26.10)	LHRRVEAQMVL....PPPPMLQAADMqlDLAGdatnledsIVV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19281 with Med5 domain of Kingdom Fungi
Unable to open file!