<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19280

Description Mediator of RNA polymerase II transcription subunit 14
SequenceMESGGQNGALPDHHKDSAVNGVNGVKSVDGSKAAPDKGKAPATATANNGNDAVNGGATGGLRTDSPAEQVSRMNDLPDEIVHITQGFIPISLLLTRLAQSTHNMIQDKIAELAKMPISTAATNGSTNYTQSAPDDTSMENLKKKGVLLNFIQDMHSKWVKALVITEWSRKASKVSKLIDLKFHIDQQRQLYDAALDSIINVKRDLTYARMPSPDLKTALQILATGKAPWLPDLQYIELPPLTLEEQLRGIGDLDTLLSLRLNLDDFDKIPYQFQNYTIGSGRVTFKVAGEFEVDLTIADEDFEKQFWFIDFRFAFRPATLSLPDTLRAFLENCVNEALAKDGLAGCYQFLHEFVLTAKINELKRQALQLNRTSWSGTLAVEPLNRALAIQYWTSRSAATGLKNWIIVAVSSGRKSGGRPDPKATSSLVVKWYRDNKEVKDVEIKMDFESLSAESLLNDIVGRHIEFILSSIHSGLLATPRYKNRDTGVALKLSRADPITSCLALQVGYGGTVSLLIEPISGAFAMKPHSKFSMQPELQLNNGKNPLDDGVNFLEHLRCAIIEDELGRMGTARGWSVRKAPVNPDELKSITKMRRWSRTLWLQHGGWGSAWFVVVILSLDGDEWWLLETDPTKSLPNAHSASKFSTRLPLNKGAPQVSGTFWDNLNTFVAGAIAQAVDMRELRRLKIKSQSSGSADLSLPQQVRMPSIEVALSNIFPSMMQEAAENITPQGLGGVIESNEDLQTLSLIRPSPVSSSTTKQPWAEDMMAIRFKGVCAVASRAEPDEGHTAAHHLVCTSEAVIRVRQPTKFLALKGMVDRDVSYDPKRGEFVLQIQRPVTQSIFDILKSRVKAIDRFVNFLEAMENAKGSIIGESITLKAVVFCYSAPVSTQPKDETAALLPSPERWRVKMDLSHEDIDIHIEKGNPHLRVIDLARNLASTEGGIGPLMAWLPVSLPALKAIDQLDAEWDELSKKGQGRLNFSMKSLTWMNIKYNIFGANGTKTKTKKTICLDVRIKPRRGQVWWHAWRSDADAAADDEFNKALKTVWDGKGSNWLGLATGAAAEANDGVRDMLLAIDKAIRAAITTSPGKRTY
Length1091
PositionTail
OrganismTrichoderma gamsii
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
Aromaticity0.07
Grand average of hydropathy-0.265
Instability index39.65
Isoelectric point8.32
Molecular weight120406.20
Publications
PubMed=26893428

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU365082
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:UniProtKB-UniRule
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP19280
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     810.59|     277|     315|     289|     603|       1
---------------------------------------------------------------------------
  213-  487 (295.60/270.70)	.......................................PDLKTALQ...ILATGKAPWLPDLQYIE.LPPL...TLEEQLRGIGDLDTlLSLR...LN..L.DDFDK.IPyQFQNYtigSGRVTFK.vaG....EFEVDLTIADEDfekQFWFIDfrfaFRPaTLSLPDTLRAfLENCVNEALAKDG..LAGCY.QFLHEFVLTA.....KINELKRQALQlNRTSWSGTLAVEPLNRALAIQYWTSRSAATGLKNWIIVAVSSGrkSGG...RPDPKATSSLVvkwyRDNkEVKDVEIKMDFeslsAESLLNdIVGRhiefilssihsGLLATPRYKNRDTG
  488-  785 (430.80/299.83)	VALKLSRaDPiTSCLALQVGYGGTVSllIEPISGAFAMKPHSKFSMQPELQLNNGKNPLDDGVNFLEHLRCA...IIEDELGRMGTARG.WSVRkAPVN..P.DELKS.IT.KMRRW...SRTLWLQH.gGwgsaWFVVVILSLDGD...EWWLLE....TDP.TKSLPNAHSA.SKFSTRLPLNKGApqVSGTFwDNLNTFVAGAiaqavDMRELRRLKIK.SQSSGSADLSLPQQVRMPSIEVALSNIFPSMMQEAAENITPQG..LGGvieSNEDLQTLSLI....RPS.PVSSSTTKQPW....AEDMMA.IRFK...........GVCAVASRAEPDEG
  797-  912 (84.20/39.33)	EAVIRVR.QP.TKFLALKGMVDRDVS..YDPKRGEFVLQIQRPVTQSIFDILKSRVKAIDRFVNFLEAMENAkgsIIGESITLKAVVFC.YS...APVStqPkDETAAlLP.SPERW...RVKMDLSH........................................................................................................................................................................................................................
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.96|      20|      22|      23|      42|       2
---------------------------------------------------------------------------
   23-   42 (34.68/20.06)	NGVKSVDGSKAAPDKGKAPA
   48-   67 (33.28/18.94)	NGNDAVNGGATGGLRTDSPA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      62.63|      19|      26|      71|      91|       3
---------------------------------------------------------------------------
   71-   91 (29.36/33.57)	SRMNDLPDEIVHITQgfIPIS
  100-  118 (33.27/27.54)	STHNMIQDKIAELAK..MPIS
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19280 with Med14 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) MESGGQNGALPDHHKDSAVNGVNGVKSVDGSKAAPDKGKAPATATANNGNDAVNGGATGGLRTDSPAEQVSRMNDL
1
76










Molecular Recognition Features






MoRF SequenceStartStop




NANANA