<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19260
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MDNPSDPPLDEIQWHSPQLIHEMGGLHSNTILFYFAQSPFFERTSNNAVIMSQAMNNMSMYHFIQTREAFEGRLKTMSGLEFIVGEEPAESGPGMGTGVWVIRKQTRRKRYQEADEITVHASYFVVNENIYMAPTLADILAARIMSISSAIAKALPAAEAARRWRPSGGHSYKPPVVAATGPAGALQAARARMQDSKEGTPASAATSKSATAPALRNIEELSLERSAEEAFWVHMRHGGEYLDENPITGRPGEFHLSSTGRKPAVAPQANKAPTGISAMTGPPRLNTKVDDKKDGKAEKAPRSAMPKPKRKKSKLGGTATRTPTAA |
| Length | 326 |
| Position | Head |
| Organism | Beauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Cordycipitaceae> Beauveria.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.531 |
| Instability index | 58.75 |
| Isoelectric point | 9.56 |
| Molecular weight | 35422.80 |
| Publications | PubMed=27470140
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19260
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.99| 19| 25| 268| 288| 1
---------------------------------------------------------------------------
268- 288 (31.13/27.14) QANKAPTgiSAMTGPPRLNTK
296- 314 (34.86/22.84) KAEKAPR..SAMPKPKRKKSK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 47.04| 14| 30| 152| 167| 3
---------------------------------------------------------------------------
152- 167 (22.03/20.05) AKALPAAEAarRWRPS
183- 196 (25.01/15.31) AGALQAARA..RMQDS
---------------------------------------------------------------------------
|