<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19257
| Description |
Mediator of RNA polymerase II transcription subunit 10 |
| Sequence | MAPIDTRVNHDAIERTSKRLSTPTNHPTANLAPAEQLKDIIQDLYQIMVQVSTYDSMGRPSKDVLSNEMTTLSRSLQTLHTSASAPDALPSVPPELIEYVENGRNPDIYTREFVELVRRGNQLMSGKMRAFGAFRDVLARNMATAMPELRDDVVQVVEATGGTRAAVAPNSTSNTTPAAPAAAADPGSGTTAAAAAAAAPGAPDGAATTLG |
| Length | 211 |
| Position | Middle |
| Organism | Beauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Cordycipitaceae> Beauveria.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.284 |
| Instability index | 41.94 |
| Isoelectric point | 5.19 |
| Molecular weight | 22156.58 |
| Publications | PubMed=27470140
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19257
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.15| 14| 15| 90| 103| 1
---------------------------------------------------------------------------
90- 103 (25.87/20.72) PSV.PPELIEYVENG
106- 120 (20.27/14.75) PDIyTREFVELVRRG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.75| 19| 26| 162| 184| 2
---------------------------------------------------------------------------
162- 184 (27.91/18.83) GTRAAVApnstSNTTPAAPAAAA
189- 207 (33.83/14.21) GTTAAAA....AAAAPGAPDGAA
---------------------------------------------------------------------------
|