<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19252
| Description |
Mediator of RNA polymerase II transcription subunit 21 |
| Sequence | MSDSLTQLQDAVDQLAQQFVASLHFVHRRHDLETLGPNDKIRDVKQEPNQKEAGLNELSRDLVFKEQQIEYLISLLPGLNNSEQDQERAIKDLEEDLKAAEAERQEALKERDAILTQLDSVICSIRRP |
| Length | 128 |
| Position | Middle |
| Organism | Beauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Cordycipitaceae> Beauveria.
|
| Aromaticity | 0.03 |
| Grand average of hydropathy | -0.726 |
| Instability index | 53.72 |
| Isoelectric point | 4.71 |
| Molecular weight | 14690.23 |
| Publications | PubMed=27470140
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 ARBA:ARBA00003669
ECO:0000256 RuleBase:RU366036
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19252
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.43| 14| 15| 79| 92| 1
---------------------------------------------------------------------------
79- 92 (22.75/16.54) LNNSEQDQERAIKD
97- 110 (20.69/14.38) LKAAEAERQEALKE
---------------------------------------------------------------------------
|