<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19251
Description |
Mediator of RNA polymerase II transcription subunit 16 |
Sequence | MSGMLKMYWSQNNGRMEETTMELESICSSDDLVTHASLATDKRYLIIVFTTATKKLKVVKLEIQWAGPGAVQEKTQLSLTARLNPSLVEDHLASIDWLQMVDEPSLPEFTSLQALPSIVASIGTPGPPLIIGARARSSGIGGFEMMQTIIDRWECVEQKPAIQKAFEQMRSRRNSVSTTQELPVLTRLKRLDPITINKTVISMQVSQYGKVLILVMSDGSVEHRDRFTFEQLYTTTDDSRISSLAAAGWTFAEDGPCYQAAFSPTQCSIIQTGDDGKLNWRKLQYAQGDIGESNSDGAYSATVAGLAIAAAPCIVTQSNFDDLLAIAHPLAEKKRFASDWIQELIKMLKVQIDYTQESHHESLMRNTPLQFCMSIMNSLGFKGENAPRTFQGKFAYIFLNVRIIVVLATLASNTPPQARDKMSPLDEPGKFFAKHVHYTYAP |
Length | 442 |
Position | Tail |
Organism | Beauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Cordycipitaceae> Beauveria.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.170 |
Instability index | 40.06 |
Isoelectric point | 6.11 |
Molecular weight | 49130.76 |
Publications | PubMed=27470140
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP19251
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 118.70| 39| 242| 58| 99| 2
---------------------------------------------------------------------------
58- 99 (54.30/57.69) VVKLEIQwAGPGAVQEKTQLSLTARLNPsLVEDH.LASiDWLQ
303- 342 (64.40/48.76) VAGLAIA.AAPCIVTQSNFDDLLAIAHP.LAEKKrFAS.DWIQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 82.06| 22| 255| 105| 126| 4
---------------------------------------------------------------------------
105- 126 (39.30/23.43) SLPEFTSLQALPSIVASIGTPG
362- 383 (42.76/26.03) SLMRNTPLQFCMSIMNSLGFKG
---------------------------------------------------------------------------
|