<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19250
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MTTAEDMPMMLDTAMSVGLGGVDDLFGDEVPLSLPSKTQGRHLHQRLDDLRNRGCCQTIAWSRAGTIASITPDGLSLELRMLRAHPANGSWGMSEPTTTDLVKGTVTNPLVHLEWSTTTAPDLAIFDSTGRVMIINFPVSLNAPFANRKWDADTVDDMNAIVGCHWLPVPPISQVS |
| Length | 176 |
| Position | Tail |
| Organism | Beauveria bassiana (White muscardine disease fungus) (Tritirachium shiotae) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Cordycipitaceae> Beauveria.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.088 |
| Instability index | 30.98 |
| Isoelectric point | 4.87 |
| Molecular weight | 19097.57 |
| Publications | PubMed=27470140
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19250
No repeats found
|