<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19232
| Description |
Uncharacterized protein |
| Sequence | MVSNDIRSLTRSGNSSPRSSLHRCNSLMLPNKGRRPATRNRRHSCLRGRTNGSNGRLPHLTASRVGGFGEWPVQLAQGAFPAERRAGQQSAWLGALQPVQLADGGWEQEPSGTLKELSPMGKTSSNYTPISSATHGIGINSRQSINGEPGGAAIPSQPLKCLDVRHSTNRNGKTGSGQKLLEMLVSRKIECSRATWYIRVIGLNEIF |
| Length | 207 |
| Position | Kinase |
| Organism | Puccinia coronata var. avenae f. sp. avenae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.621 |
| Instability index | 60.83 |
| Isoelectric point | 11.15 |
| Molecular weight | 22423.10 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19232
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.80| 20| 20| 22| 41| 1
---------------------------------------------------------------------------
22- 41 (38.40/18.78) HRC.NSLMLPNKGRRPA.TRNR
43- 64 (29.40/13.06) HSClRGRTNGSNGRLPHlTASR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.13| 13| 23| 71| 93| 2
---------------------------------------------------------------------------
71- 83 (27.24/26.28) W.....PVQLAQGAFPAE
92- 109 (22.89/ 6.81) WlgalqPVQLADGGWEQE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.80| 17| 44| 110| 126| 3
---------------------------------------------------------------------------
110- 126 (30.38/20.84) PSGTLKELSPMGKTSSN
155- 171 (32.41/22.68) PSQPLKCLDVRHSTNRN
---------------------------------------------------------------------------
|