<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19230
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MSTEVSVIGVVNNELYQTVLNRLGNHTHSFSHFTSQEIGFDRGSFDTASEDSNILRLKHTIRKPEISNNHSPLNFKNPIRNGWTLTSLGRIEPERLSPDFSIRPFYFCPILAGNPIEFVGALGYRRKFEYFRRGVQFLRGGVIIEIFRVYHNEHDETPMAGPEGHVITITAIIPTAARTTPTTTTTTTTTTAAAAAASTATAAAVATSGATNTNAGAGTAVSSSGATVQELRSEACARVREIQAILKGLADLGRVEPA |
| Length | 258 |
| Position | Head |
| Organism | Puccinia coronata var. avenae f. sp. avenae |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.178 |
| Instability index | 42.70 |
| Isoelectric point | 7.89 |
| Molecular weight | 27860.95 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364150
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19230
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.97| 18| 28| 78| 103| 1
---------------------------------------------------------------------------
78- 95 (33.05/27.32) PIRNGWTLTSLGRIEPER
109- 126 (31.91/11.15) PILAGNPIEFVGALGYRR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.89| 14| 15| 170| 183| 3
---------------------------------------------------------------------------
170- 183 (24.29/12.74) TAIIPTAARTTPTT
186- 199 (20.60/ 9.78) TTTTTTAAAAAAST
---------------------------------------------------------------------------
|