<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19228
Description |
Uncharacterized protein |
Sequence | MSPMGKTSSNYTPILSATHGIGINSHQSMNGEPGGAVPGRVTLNEQKQENWLRELANDLVPLLKLSRNVPHGFKGQKLLEMLNAQRNKNNLSHIRYTLAFTSDVFQFLQKQLTEVMVPLQMNPSLSTTSLITTSIPLAAMNEDAIQKHSADNSQQPATAAIHSCSPSGSTDSSTCLDEEDELDGNGFMRSTGCNQQVLRSSCKRPK |
Length | 206 |
Position | Kinase |
Organism | Puccinia coronata var. avenae f. sp. avenae |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Pucciniomycotina>
Pucciniomycetes> Pucciniales> Pucciniaceae> Puccinia.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.514 |
Instability index | 53.75 |
Isoelectric point | 7.00 |
Molecular weight | 22468.09 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19228
No repeats found
No repeats found
|