<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19215
| Description |
Uncharacterized protein |
| Sequence | MSANYWVSTHHNHWVFPKDQLASMRQKLEKENSDLVQTFSLPETRHLYIYFNQQISRLSKRLKIRQQAIATAQVYIKRFYIRVEIRRTNPYLVIATAVYLACKIEECPQHIRLIVSEARSLWQDFISLDTSKLGECEFFLISEMSSQLIVHQPYRTLTSLQTDLRISNEDFALAWSIINDHYMTDLPLLYAPHTIALTAILLALVLRPNPPSSGGQVPGGISSPQTPGSLPNAAAAVGAAAAALAQAQNRSLTPGGTPTPSDKEKPMEAKVGRVQRFVVWLADSDVDIAAMVDCTQEIISFYNAQEQYNDKLTREQISRFVKARGLDK |
| Length | 328 |
| Position | Kinase |
| Organism | Lomentospora prolificans |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Microascales> Microascaceae> Lomentospora.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.192 |
| Instability index | 50.21 |
| Isoelectric point | 8.58 |
| Molecular weight | 36976.92 |
| Publications | PubMed=28963165
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19215
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.60| 24| 34| 102| 135| 1
---------------------------------------------------------------------------
102- 130 (34.80/41.08) CK...IEECPQhiRLIVSEArslWQDFISLDT
136- 162 (37.80/17.89) CEfflISEMSS..QLIVHQP...YRTLTSLQT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.74| 18| 31| 45| 64| 2
---------------------------------------------------------------------------
45- 64 (26.20/24.84) RHLYIYFnqQISRLSKRLKI
77- 94 (31.54/21.94) KRFYIRV..EIRRTNPYLVI
---------------------------------------------------------------------------
|