Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MSFHHPHTPQTPSQPSPGITDPLASTTASMTSNTSALPTPAHSVTGASSQPSDITYETSMMDAGEELTPNKRKRLMEDLGDHAVKKMHLDTPPLGIEDIHLDVGEKYLLCNRPVRVPQYSTAEDLFAMFDLTGLATKMAREKPNGEKNALRKSFKSQVKELAIDGAYDTKKDERQDNDPDGFFAMLNLPEDVWYAHHVKGQEIQDGFSETTLASLPKALSMLKGKVRKEHWDPYILGSLESPAQLIDNSSNTANSAKASELNTPAGSTPAASARLKVTGQALAPGQDPSRPRRSIKKRSYGDASFEGYGEGYPDDEGGYSTGDGEDRNGTKRRKKNSSAPQPFSQIRQQGYGPGMVGA |
Length | 358 |
Position | Head |
Organism | Lomentospora prolificans |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Hypocreomycetidae> Microascales> Microascaceae> Lomentospora. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.809 |
Instability index | 46.60 |
Isoelectric point | 6.09 |
Molecular weight | 38892.79 |
Publications | PubMed=28963165 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19209 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 89.90| 26| 37| 279| 305| 1 --------------------------------------------------------------------------- 279- 305 (42.54/27.97) GQALAPGQDPSRPRRSiKKRSYGDASF 318- 343 (47.36/27.10) GYSTGDGEDRNGTKRR.KKNSSAPQPF --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 110.63| 33| 39| 42| 74| 3 --------------------------------------------------------------------------- 42- 74 (56.69/32.37) HSVTGASSQPSDITYETSMMDAGEE.LTPNKRKR 82- 115 (53.94/30.50) HAVKKMHLDTPPLGIEDIHLDVGEKyLLCNRPVR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 59.14| 17| 21| 199| 215| 4 --------------------------------------------------------------------------- 199- 215 (27.86/15.71) KGQEIQDGFSETTLASL 223- 239 (31.28/18.38) KGKVRKEHWDPYILGSL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EGYGEGYPD 2) PFSQI | 306 342 | 314 346 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab