<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19190
| Description |
Mediator of RNA polymerase II transcription subunit 4 |
| Sequence | MQALETTLAAFQEHTTQLFNALNAQASLVVHDAQARDTSVAEHLAALEKLDASLGPTLAMAATHQANQARLNPLLQEVKQRDAQQRDAIAEIASMRGELQSLLQMGEAERDEMQRAEQNPLLYKDVLHYAQRLSKYTAAPPGYRLEVQNEGVQSNGPAVRLAADYNQQAARAAGYYDPAISSMAQDLPYPSDRLMRQGILYADAAADGVQPEPGQGSAPTHDTTEASTAHEPVPEALDAFAMDDDDAFDLDLNP |
| Length | 254 |
| Position | Middle |
| Organism | Malassezia vespertilionis |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina>
Malasseziomycetes> Malasseziales> Malasseziaceae> Malassezia.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.502 |
| Instability index | 33.87 |
| Isoelectric point | 4.47 |
| Molecular weight | 27566.12 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19190
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
4| 191.80| 42| 46| 31| 75| 1
---------------------------------------------------------------------------
2- 30 (25.28/ 9.58) ...QALETTLAafqEHTTQL..................FNALNAQASLVV
31- 75 (63.24/41.34) HDAQARDTSVA...EHLAALEkldASLGPTLAM..AATHQANQARLNPLL
81- 122 (56.50/30.12) RDAQQRD.AIA...E.IASMR...GELQSLLQMgeAERDEMQRAEQNPLL
136- 171 (46.78/23.73) YTAAPPGYRLE...VQNEGVQ....SNGPAVRL..AADYNQQAAR.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 82.72| 18| 42| 173| 190| 2
---------------------------------------------------------------------------
173- 190 (33.21/15.66) AGYYDPAISSMAQDLPYP
198- 213 (20.24/ 7.34) GILYADAAADGVQPEP..
218- 234 (29.26/13.13) APTHDTTEASTAHE.PVP
---------------------------------------------------------------------------
|