<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19187

Description Rpl2ap
SequenceMPTDPAVEETNTAREANQQRFSRDLEFLSALCNPFYLHQLSQQGFLDDPAFLAYLRYLNYFRAPAYVRYLVYPQALHFLALLQHAEFRFAVADTAWPHDTAAKQIAHWATWRPSPPPPPPKTKTEAPRDEGIRAPLIRLVDPSSGKVTGPFKPRDIVQKLDRKTYSLVQVAQGAGGTEKKAEWALEELPICKLVSKREEYQKQREQKRRATTSGAPATSKDMQLTWNVSTNDLAHKVARAQKELRKCHKVRVVILSKKGTKRVLPGSAEEDVRIRLVDSIKHALTMSTEDPNAVVARVVQEPIWKNQRSMLEMHIEPRAFLILQGLLRGSHITLDLHAAITDSNFEGFKFVPTGVHCFTWQSAGASDEAMASTGLRNCTFFYTKGHQVVLRQYDPSQDAFQHEADLGGELLVSEDHMRTLDPHLAPYTGIGVDTWTSITRYLATHASVLARVFAVNLASADPCCDSFTPVASQGPGSDVFLEPPTEMPALHFTAFTLQHSWPPEAQGEERTKWSVDKSWLLEDVLERAAVCLDNEPLYTALLCEVELSFVLFLQANNAEALAYWVELLTLFSRASSRLGAPGRYELHPCEWDDTMRTSTPLRVPQLDAHIAYIRTLAAQFAAMPPTIWTEELSTAEARVLKDLAQLRANIARALGTWAALQHEPNLPTPPYEQLLAQWRAMANTCVTRFGWTLDTVLDEEVEADELEEEDDAPVVREREASNIAVIRAQRKSGGIFTAHTRLNKAPAKLRPYDFAERNGYIRGLVKEIIHDAGRGAPLAHVTFRDPYRYKMVTETFIAAEGMHTGQFVYCGKKATLSVGNVLPLSSLPEGTIVCNVEEKSGDRGALARTSGNYATIIGQDPEHNTCRIRLPSGAKKTVPDSSRATVGVVAGGGRIDKPLLKAGRAFHKYKVKRNSWPRTRGVAMNPVDHPHGGGNHQHIGHSSTVKRDSVPGQKAGLIAARRTGLHRGTIKSRDA
Length975
PositionMiddle
OrganismMalassezia vespertilionis
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Basidiomycota> Ustilaginomycotina> Malasseziomycetes> Malasseziales> Malasseziaceae> Malassezia.
Aromaticity0.08
Grand average of hydropathy-0.374
Instability index38.38
Isoelectric point8.46
Molecular weight108514.10
Publications









Function






Annotated function


GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
ribosome	GO:0005840	IEA:UniProtKB-KW

GO - Biological Function
structural constituent of ribosome	GO:0003735	IEA:InterPro
transcription coregulator activity	GO:0003712	IEA:InterPro
translation initiation factor activity	GO:0003743	IEA:InterPro

GO - Biological Process
regulation of transcription, DNA-templated	GO:0006355	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP19187
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      59.98|      17|      24|      18|      40|       1
---------------------------------------------------------------------------
   18-   37 (27.13/28.70)	QQRFSRDLEFLSALCnpfYL
   42-   58 (32.86/14.90)	QQGFLDDPAFLAYLR...YL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      92.17|      19|      24|     390|     408|       2
---------------------------------------------------------------------------
  390-  408 (36.05/21.63)	LRQYDPSQDAFQHEADLG.G
  417-  429 (24.91/12.62)	MRTLDP......HLAPYT.G
  457-  476 (31.22/17.72)	LASADPCCDSFTPVASQGpG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      88.57|      27|     413|      75|     111|       3
---------------------------------------------------------------------------
   75-  111 (42.61/39.24)	ALHFLAL.LQHaEfrfavadtaWPHDTAAKQIAHWA...TW
  489-  519 (45.96/22.39)	ALHFTAFtLQH.S.........WPPEAQGEERTKWSvdkSW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.85|      18|      24|     112|     129|       4
---------------------------------------------------------------------------
  112-  129 (36.05/18.45)	RPSPPPPPPKTKTEAPRD
  138-  155 (32.80/16.14)	RLVDPSSGKVTGPFKPRD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      55.48|      18|      21|     261|     278|       5
---------------------------------------------------------------------------
  261-  278 (29.79/17.49)	KRVLPGSAEED..VRIRLVD
  281-  300 (25.69/14.16)	KHALTMSTEDPnaVVARVVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      32.30|      10|      22|     311|     320|       6
---------------------------------------------------------------------------
  311-  320 (18.99/11.63)	LEMH..IEPRAF
  334-  345 (13.31/ 6.14)	LDLHaaITDSNF
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP19187 with Med31 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KVKRNSWPRTRGVAMNPVDHPHGGGNHQHIGHSSTVKRDSVPGQKAGLIAARRTGLHRGTIKSRDA
910
975










Molecular Recognition Features






MoRF SequenceStartStop




1) FHKYK
906
910