<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19174
Description |
Uncharacterized protein |
Sequence | MSASYWQSTQCRFWTFTKEQLATMRQKLEEDNAELVRMFPLPQQRHLNIYFNQQLIRLAKRLTIRQQSMATAQVYMKRFYSKVEIRRTNPYLVIATAIYLACKIEESPQHIRLIVTEARQMWGDLVAIDTSKLGECEFMMISEMRSQLIVYQPYRTVIALRSELGLQEDEVQLARSVINDHFMTDLPLLYPPHVIAMVAMLLALVLRPNNSGHGQNASGAAAAAGLAAAQQALMRAQGQQTPGGGTTEAATAEPKERQQQARVSRVQRFAKWLVDSNVDIASMVDATQEIISFYECYEHYNDKLTREQINRFVKARGLDK |
Length | 320 |
Position | Kinase |
Organism | Fusarium venenatum |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.286 |
Instability index | 53.52 |
Isoelectric point | 8.97 |
Molecular weight | 36624.77 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19174
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 75.48| 24| 27| 214| 237| 1
---------------------------------------------------------------------------
214- 237 (39.06/22.08) GQNASGAAAAAGLAAAQQA.LMRAQ
243- 267 (36.43/20.18) GGGTTEAATAEPKERQQQArVSRVQ
---------------------------------------------------------------------------
|