<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19165
| Description |
Uncharacterized protein |
| Sequence | MDSTSSTNLLDKHNKLIFEILRSYRDLMNCATIQGMDRDNQKDFESQTTKLNYRDPETMAAAEIRTQRKFDQLHDNIKQLLALSRTIKELWVFGPLDRADGHRQEKEVQIDRDVQEVSRLLANFDTNAMQQLAEKYGGSYEPQAAASASSATATTTQPTEPAPSTGN |
| Length | 167 |
| Position | Head |
| Organism | Fusarium venenatum |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Nectriaceae> Fusarium.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.819 |
| Instability index | 36.45 |
| Isoelectric point | 5.23 |
| Molecular weight | 18868.72 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19165
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 64.28| 19| 26| 24| 45| 1
---------------------------------------------------------------------------
24- 45 (30.62/31.89) YRDlmnCATIQGMDRDNQKDFE
53- 71 (33.66/24.58) YRD...PETMAAAEIRTQRKFD
---------------------------------------------------------------------------
|