| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | LKMDPAGSGVASSGSLRTKISLKGRYSQLSLVCPFHLMKPELPQQSVLLGSNDLLAEYDMSSSYQRFCGSKRLREDLGSFLPHLVGSFNFENALEFSSLRMLVEKPPITGKEITNLSASAMAGFRLTPGAVPEPYRYFDNKIDDLNGDATNYDENGEETKHKRKYKWSLDDLDDADSDRKNRKHRSEEKDRKKEKKKKKDKKRKVIVAATHTIH |
| Length | 214 |
| Position | Head |
| Organism | Onchocerca volvulus |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Spirurina> Spiruromorpha> Filarioidea> Onchocercidae> Onchocerca. |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.849 |
| Instability index | 40.56 |
| Isoelectric point | 9.33 |
| Molecular weight | 24268.26 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP19163
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 99.18| 28| 28| 135| 162| 1
---------------------------------------------------------------------------
135- 162 (50.05/36.39) YRYFDNKIDDLNGDATNYDENGEETKHK
165- 192 (49.12/35.57) YKWSLDDLDDADSDRKNRKHRSEEKDRK
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) RKKEKK 2) YKWSLDDLDDA 3) YRYFDN | 191 165 135 | 196 175 140 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab