Description | Mediator of RNA polymerase II transcription subunit 11 |
Sequence | MATYSLANERLRALEDIEREIGAILQNAGTVILELSKEKTNERLLDRQAAAFTASVQHVEAELSAQIRYLTQLPGGITNSNSGKK |
Length | 85 |
Position | Head |
Organism | Saimiri boliviensis boliviensis (Bolivian squirrel monkey) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae> Saimiriinae> Saimiri. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.336 |
Instability index | 27.46 |
Isoelectric point | 5.78 |
Molecular weight | 9327.42 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364147 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19159 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.53| 24| 31| 8| 36| 1 --------------------------------------------------------------------------- 8- 36 (33.02/35.05) NERLraledIEREIGAILQNAGTVILELS 41- 64 (39.51/28.08) NERL.....LDRQAAAFTASVQHVEAELS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) NERLLDRQAAAFTASVQHVEAELSAQIRYLTQLPGGITNSNSGK 2) YSLANERLRALEDIEREIGAILQNAGTVILEL | 41 4 | 84 35 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab