<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19140
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | MGEPQQVSALSPPPMQSIKEYMNENIQEGLAPKPPAPIKDRYMMFVNQFQCDDLIHPLESQSIKQLHPMQKLNMSILINFLDLLDILIRSPGSIKQEEKLEDLKLFVHVHHLIYEYRPHQVKDTFRVMMEVQKQQQLEANCLASLPDDSPHSEAGMRVKTKPMDADDSNNCTGQNDQRRENSGHRRNQITEKDAALCVLIDEMNERP |
Length | 207 |
Position | Middle |
Organism | Saimiri boliviensis boliviensis (Bolivian squirrel monkey) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Saimiriinae> Saimiri.
|
Aromaticity | 0.04 |
Grand average of hydropathy | -0.705 |
Instability index | 55.43 |
Isoelectric point | 5.47 |
Molecular weight | 23885.06 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19140
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.99| 16| 19| 6| 22| 1
---------------------------------------------------------------------------
6- 22 (27.20/21.08) QvSALSPPPMQSIKE.YM
27- 43 (27.79/16.59) Q.EGLAPKPPAPIKDrYM
---------------------------------------------------------------------------
|