<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19127
Description |
Mediator complex subunit 29 |
Sequence | RSPRKAGCDEVGGKMAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQITCAKDIHTALLDCANKVTGKTPAPPAGPGGTL |
Length | 214 |
Position | Tail |
Organism | Saimiri boliviensis boliviensis (Bolivian squirrel monkey) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Saimiriinae> Saimiri.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.429 |
Instability index | 69.70 |
Isoelectric point | 6.96 |
Molecular weight | 22528.28 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP19127
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.71| 19| 23| 29| 51| 1
---------------------------------------------------------------------------
33- 51 (38.73/17.19) GPSSAGGPGPQQQPQPPAQ
54- 72 (34.98/ 8.97) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
|