<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19120

Description Mediator complex subunit 25
SequenceMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGCTTENLVQQIGERGIHFSIVSPRKLPALRLLFEKAAPPALLEPLQPPTDVSQDPRHMVLVRGLVLPVGGGSAPGPLQPKQPVPLPPAAPSGATLSAAPQQPLPPVPPQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPITPLQQAAPGVGPPFSQAPAPPLPPGPPGAPKPPPASQPSLVSTVAPGSGLAPTAQPGAPSMAGTVAPGGVSGPSPAQLGAPALGGQQSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQQRGLQLRPPQPQPQGTVGASGATGQPQPQNTTQPPPGAPQGPPGAASGPPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI
Length620
PositionUnknown
OrganismSaimiri boliviensis boliviensis (Bolivian squirrel monkey)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae> Saimiriinae> Saimiri.
Aromaticity0.04
Grand average of hydropathy-0.290
Instability index62.63
Isoelectric point9.56
Molecular weight64766.01
Publications

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP19120
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     133.35|      29|      30|      82|     110|       6
---------------------------------------------------------------------------
   82-  110 (47.33/ 9.51)	PRKLPALRLLFEKAAP...PALLEPLQPPTDV
  114-  142 (44.45/ 8.45)	PRHMVLVRGLVLPVGG...GSAPGPLQPKQPV
  502-  533 (41.56/ 7.39)	PPPGPILRPQNPGANPqlrSLLLNPPPPQTGV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      67.20|      17|      62|     158|     179|       8
---------------------------------------------------------------------------
  161-  179 (28.85/10.44)	PLPPVPPqyQVPGNLSAAQ
  224-  240 (38.35/ 6.02)	PLPPGPP..GAPKPPPASQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     123.55|      33|     120|     452|     485|      11
---------------------------------------------------------------------------
  452-  485 (58.84/27.28)	QQRGLQLRPPQPQPqGTVGASGATGQPQPQNTTQ
  575-  607 (64.70/27.08)	QSWPAQLPPRAPLP.GQMLLSGGPRGPVPQPGLQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.62|      22|      25|     361|     384|      12
---------------------------------------------------------------------------
  361-  384 (34.11/27.93)	LFrnSRMVQF.HFTNKDLESLKGLY
  390-  412 (37.50/23.78)	GF..AGCVHFpHTAPCEVRVLMLLY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.71|      15|      23|     319|     333|      13
---------------------------------------------------------------------------
  319-  333 (28.29/19.64)	KLTRSL.PCQVYVNHG
  344-  359 (21.42/12.78)	KLIMQLiPQQLLTTLG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP19120 with Med25 domain of Kingdom Metazoa

Unable to open file!