<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19091
| Description |
Uncharacterized protein |
| Sequence | MASAGVAAGRQAEDALPPTSDQPLPDSKPLPPPQPPPPVAAPQPQQSPASRPQSPARAREEENYSFLPLVHIIIKWL |
| Length | 77 |
| Position | Middle |
| Organism | Saimiri boliviensis boliviensis (Bolivian squirrel monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Saimiriinae> Saimiri.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.600 |
| Instability index | 114.55 |
| Isoelectric point | 5.62 |
| Molecular weight | 8207.21 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19091
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.65| 17| 17| 17| 33| 1
---------------------------------------------------------------------------
17- 33 (34.84/ 8.60) PPTSDQPLPDSKPLPPP
36- 52 (33.81/ 8.18) PPPVAAPQPQQSPASRP
---------------------------------------------------------------------------
|