<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19082
Description |
Uncharacterized protein |
Sequence | IAGNFWQNLLKEHQKDLKFLSEGEYWKLQIFFTNVIRALGEHLKLRQVTATAMVYFKRFYARYSLKSIDLVLMAPTCLFLESKVEEFGVVSNTKLTAAATSVLKTRFSHAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYSPLLQHVQDVGQEDMLLPLAWRIVNDAYRMDLCLLYPPLMIALACLHIACVVQQKDARQWFAELYVDIEKILKIIRIPKNSIVDHSGNKPLDRFQ |
Length | 238 |
Position | Kinase |
Organism | Saimiri boliviensis boliviensis (Bolivian squirrel monkey) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Saimiriinae> Saimiri.
|
Aromaticity | 0.12 |
Grand average of hydropathy | 0.097 |
Instability index | 34.95 |
Isoelectric point | 8.15 |
Molecular weight | 27852.49 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19082
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.32| 16| 52| 117| 135| 1
---------------------------------------------------------------------------
117- 135 (28.72/24.60) YRMNHileCEFY..LLELMDC
171- 188 (26.60/14.95) YRMDL...CLLYppLMIALAC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.63| 15| 17| 20| 36| 2
---------------------------------------------------------------------------
20- 36 (24.17/19.13) LseGEYWKL.QIFFTNVI
39- 54 (21.47/11.02) L..GEHLKLrQVTATAMV
---------------------------------------------------------------------------
|