<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19079
| Description |
Mediator of RNA polymerase II transcription subunit 31 |
| Sequence | MVAAVAMETDDSGNRLRFQLELEFVQCLANPNYLNFLAQRGYFKDKAFVNYLKLLYWKDPEYAKYLKYPQCLHMLELLQYEHFRKELVNAQCAKFIDEQQILHWQHYSRKRMRLQQALAEQQQQNNTSGK |
| Length | 130 |
| Position | Middle |
| Organism | Saimiri boliviensis boliviensis (Bolivian squirrel monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Saimiriinae> Saimiri.
|
| Aromaticity | 0.14 |
| Grand average of hydropathy | -0.640 |
| Instability index | 31.39 |
| Isoelectric point | 8.73 |
| Molecular weight | 15685.83 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19079
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 81.35| 18| 20| 52| 71| 1
---------------------------------------------------------------------------
52- 71 (29.01/21.75) LKLLYWKdpEYA.KYLKYPQC
75- 92 (30.29/15.89) LELLQYE..HFR.KELVNAQC
99- 116 (22.04/ 9.96) QQILHWQ..HYSrKRMRLQQ.
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 57.15| 16| 16| 18| 33| 2
---------------------------------------------------------------------------
18- 33 (28.86/20.44) FQLELEFVQCLANPNY
36- 51 (28.29/19.91) FLAQRGYFKDKAFVNY
---------------------------------------------------------------------------
|