<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19078
| Description |
Uncharacterized protein |
| Sequence | MAAPLGGMISGQPPGPPQPPPGLPGQASLLQAAPGTPRPSNSTLVEELESSFEACFASLVSQDYVSGTDQEEIRTGVDQCIQKFLDIARQKECFFLQKRLQLSIQKPEQVIKEDVSELRNELQRKDVLVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANILAPLKPT |
| Length | 178 |
| Position | Head |
| Organism | Saimiri boliviensis boliviensis (Bolivian squirrel monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Saimiriinae> Saimiri.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.448 |
| Instability index | 61.71 |
| Isoelectric point | 5.64 |
| Molecular weight | 19641.20 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19078
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 58.16| 14| 16| 117| 130| 1
---------------------------------------------------------------------------
99- 112 (18.61/11.45) RLQLSIQ.KPEQVIK
117- 130 (20.16/12.97) ELRNELQ.RKDVLVQ
135- 149 (19.40/12.22) KLRHWQQvLEDINVQ
---------------------------------------------------------------------------
|