| Description | Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MCMIDHLRRLHLGAYPTEECKACTRCGCVTMLKSPNRTTAVKQWEQRWIKNCLCGGLWWRVPLSYP |
| Length | 66 |
| Position | Tail |
| Organism | Saimiri boliviensis boliviensis (Bolivian squirrel monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae> Saimiriinae> Saimiri. |
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.295 |
| Instability index | 82.21 |
| Isoelectric point | 9.18 |
| Molecular weight | 7741.15 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364149 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | |
| GO - Biological Process |
| Binary Interactions |
| Repeats | >MDP19076 No repeats found No repeats found |
| MoRF Sequence | Start | Stop |
| 1) NCLCGGLWWRVPLSYP 2) VKQWEQRWI | 51 41 | 66 49 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab