<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19069
Description |
Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MKITNPRHLGSAEAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPLPTAATAPPGADKSGPGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGRPSC |
Length | 212 |
Position | Head |
Organism | Saimiri boliviensis boliviensis (Bolivian squirrel monkey) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Saimiriinae> Saimiri.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.613 |
Instability index | 58.41 |
Isoelectric point | 9.34 |
Molecular weight | 22424.51 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP19069
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 79.31| 18| 18| 56| 73| 3
---------------------------------------------------------------------------
54- 70 (25.09/ 8.34) G...gGPGT...APLPTAATAPP
71- 90 (29.68/11.00) GADksGPGC...GPFYLMRELPG
132- 152 (24.54/ 8.02) MID..LPGShdnSSLRSLIEKPP
---------------------------------------------------------------------------
|