Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MKITNPRHLGSAEAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPLPTAATAPPGADKSGPGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
Length | 261 |
Position | Head |
Organism | Saimiri boliviensis boliviensis (Bolivian squirrel monkey) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae> Saimiriinae> Saimiri. |
Aromaticity | 0.04 |
Grand average of hydropathy | -1.004 |
Instability index | 60.74 |
Isoelectric point | 9.81 |
Molecular weight | 28148.88 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP19068 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 82.76| 13| 34| 34| 46| 1 --------------------------------------------------------------------------- 34- 46 (27.91/ 7.76) PPTALGFGPGKPP 51- 63 (26.84/ 7.22) PPPGGGPGTAPLP 69- 81 (28.01/ 7.81) PPGADKSGPGCGP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 54.26| 16| 16| 207| 222| 3 --------------------------------------------------------------------------- 207- 222 (27.24/13.77) PETPSDSDHKKKKKKK 226- 241 (27.02/13.60) PERKRKKKEKKKKKNR --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 91.06| 20| 115| 127| 147| 4 --------------------------------------------------------------------------- 127- 147 (32.34/17.11) PDLPGMIdLPGSHDNSSLRSL 159- 176 (28.27/11.08) NPITGTM.LAGFRLHTG..PL 244- 260 (30.45/12.38) PDHPGM....GSSQASSSSSL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDH 2) NFTALFG | 212 20 | 246 26 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab