<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19068
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKITNPRHLGSAEAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPLPTAATAPPGADKSGPGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 261 |
| Position | Head |
| Organism | Saimiri boliviensis boliviensis (Bolivian squirrel monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Saimiriinae> Saimiri.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.004 |
| Instability index | 60.74 |
| Isoelectric point | 9.81 |
| Molecular weight | 28148.88 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19068
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 82.76| 13| 34| 34| 46| 1
---------------------------------------------------------------------------
34- 46 (27.91/ 7.76) PPTALGFGPGKPP
51- 63 (26.84/ 7.22) PPPGGGPGTAPLP
69- 81 (28.01/ 7.81) PPGADKSGPGCGP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.26| 16| 16| 207| 222| 3
---------------------------------------------------------------------------
207- 222 (27.24/13.77) PETPSDSDHKKKKKKK
226- 241 (27.02/13.60) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 91.06| 20| 115| 127| 147| 4
---------------------------------------------------------------------------
127- 147 (32.34/17.11) PDLPGMIdLPGSHDNSSLRSL
159- 176 (28.27/11.08) NPITGTM.LAGFRLHTG..PL
244- 260 (30.45/12.38) PDHPGM....GSSQASSSSSL
---------------------------------------------------------------------------
|