<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19064
| Description |
Cyclin dependent kinase 19 |
| Sequence | TSGCKENLLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYMEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDEPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGTGTGLQHSQDSGLNQVPPNKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSSQYHPSHQAHRY |
| Length | 397 |
| Position | Kinase |
| Organism | Saimiri boliviensis boliviensis (Bolivian squirrel monkey) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Saimiriinae> Saimiri.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.794 |
| Instability index | 58.52 |
| Isoelectric point | 8.67 |
| Molecular weight | 44784.86 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP19064
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 106.61| 32| 32| 305| 336| 1
---------------------------------------------------------------------------
283- 321 (52.79/24.48) QAAAPPQAPPPQQNStqtngtaGGAGAGVGG..TGTGLQHS
322- 356 (53.82/25.09) QDSGLNQVPPNKKPR......lGPSGANSGGpvMPSDYQHS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.46| 14| 15| 358| 371| 4
---------------------------------------------------------------------------
358- 371 (26.41/14.14) SRLNYQSSVQGSSQ
374- 387 (26.04/13.86) STLGYSSSSQQSSQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.52| 16| 17| 214| 229| 7
---------------------------------------------------------------------------
214- 229 (28.65/19.60) DPTKRITSEQALQDPY
233- 248 (30.88/21.70) DPLPTLDVFAGCQIPY
---------------------------------------------------------------------------
|