| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKITNARHRDRAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 261 |
| Position | Head |
| Organism | Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Colobinae> Rhinopithecus. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -1.044 |
| Instability index | 60.93 |
| Isoelectric point | 9.91 |
| Molecular weight | 28178.87 |
| Publications | PubMed=25362486 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP19018
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.11| 16| 16| 31| 46| 1
---------------------------------------------------------------------------
31- 46 (36.40/11.14) PPPPPTALGFGPGKPP
48- 63 (37.71/11.79) PPPPPPGGGPGTAPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 93.72| 28| 115| 116| 147| 2
---------------------------------------------------------------------------
116- 147 (46.33/24.76) KKVKEKLSN.FLPDLPGMidlpGSHDNSSLRSL
232- 260 (47.40/18.91) KKEKKKKKNrHSPDHPGM....GSSQASSSSSL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.86| 16| 18| 187| 202| 3
---------------------------------------------------------------------------
187- 202 (28.50/12.52) PPK...KKNKHKHKQSRTQ
206- 224 (21.35/ 7.80) PPEtpsDSDHKKKKKKKEE
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDH 2) MENFTALFGA | 212 18 | 246 27 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab