<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP19017
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKITNARHRDRAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPVSPVGGRRQMGRPKHGDGFSVQVCSFIMEQNG |
| Length | 207 |
| Position | Head |
| Organism | Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Colobinae> Rhinopithecus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.460 |
| Instability index | 44.46 |
| Isoelectric point | 9.07 |
| Molecular weight | 21590.37 |
| Publications | PubMed=25362486
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP19017
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 62.62| 14| 14| 41| 54| 2
---------------------------------------------------------------------------
41- 54 (34.35/10.75) GPGKPPPPPPPPPG
58- 71 (28.27/ 7.60) GTAPPPTAATAPPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.00| 14| 39| 84| 97| 3
---------------------------------------------------------------------------
84- 97 (25.31/13.98) LMRELPGSTELTGS
125- 138 (27.69/15.95) FLPDLPGMIDLPGS
---------------------------------------------------------------------------
|