<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18994
Description |
Uncharacterized protein |
Sequence | MAAPLGGMFSGQPPGPPQAPPGLPGQASLLQAAPGAPRPSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEEINVQHKKPADIPQGSLAYLEQASANIPAPLKPTCRTASWSCAFSSQSPHPSLEPCPEAPGGEPLWPEPPRS |
Length | 216 |
Position | Head |
Organism | Rhinopithecus roxellana (Golden snub-nosed monkey) (Pygathrix roxellana) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Colobinae> Rhinopithecus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.523 |
Instability index | 69.71 |
Isoelectric point | 5.28 |
Molecular weight | 23622.44 |
Publications | PubMed=25362486
|
Function
Annotated function |
|
GO - Cellular Component | nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP18994
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.01| 11| 194| 3| 18| 2
---------------------------------------------------------------------------
3- 18 (19.51/17.97) APlggmfSGQP..PGPPQ
203- 215 (20.49/ 7.26) AP.....GGEPlwPEPPR
---------------------------------------------------------------------------
|