| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKTTNATHRDSAGAEGTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS |
| Length | 211 |
| Position | Head |
| Organism | Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Colobinae> Rhinopithecus. |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.664 |
| Instability index | 56.43 |
| Isoelectric point | 9.40 |
| Molecular weight | 22187.10 |
| Publications |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
| Binary Interactions |
| Repeats |
>MDP18911
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.39| 14| 39| 84| 97| 3
---------------------------------------------------------------------------
84- 97 (24.74/12.49) LMRELPGSTELTGS
125- 138 (27.66/14.76) FLPDLPGMIDLPGS
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) FGPGKP 2) MENFTALFGA 3) QPPKKKNKHKHKQSRTQ | 40 18 186 | 45 27 202 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab