<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18897

Description Uncharacterized protein
SequenceMVSPRQAPYRSGAKGPLGGHGRPARPLAVRRSWPDSPRSPQPLQLRACSAPPMKGARVFGALGPIGPSSPGLTLGGLTLSEHRLSNKLLAWSGVLKRRLYYDSTVKLKRALLCQAYLKLIMQLIPQQLMATLRSLFLAQFHFTNRGCSLLNRLCRIMSKGFAGCMPFPHISPYEMCVLMFPNSSRTKIFMGFIPYDQSGFVSAIRQVITTRKQAVGSGDRQQEVLAWTGVMEWQEPRPETNSRSKRWLPSHVYQWPRKMYMQLIPQQLLTTLMLLFLCRIMDNVRFSYKAWCEIRVLMLLYSSEKKIFIGLIPQGNFLNGILQVIVLQWNLEQEQQQQQQGMGGSGYPGWAPSGVTD
Length357
PositionUnknown
OrganismRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Colobinae> Rhinopithecus.
Aromaticity0.10
Grand average of hydropathy-0.154
Instability index62.44
Isoelectric point10.33
Molecular weight40373.04
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP18897
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     238.65|      65|     116|     167|     233|       1
---------------------------------------------------------------------------
  167-  233 (116.86/82.79)	FPHISPYEMCVLMFPNSSRTKIFMGFIPydQSGFVSAIRQVITTRKQAVGSGDRQQEVLAWTGVMEW
  286-  350 (121.80/79.62)	FSYKAWCEIRVLMLLYSSEKKIFIGLIP..QGNFLNGILQVIVLQWNLEQEQQQQQQGMGGSGYPGW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      80.49|      21|     138|     108|     139|       2
---------------------------------------------------------------------------
  119-  139 (38.86/33.99)	LIMQLIPQQLMATLRSLFLAQ
  259-  279 (41.63/16.59)	MYMQLIPQQLLTTLMLLFLCR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.22|      11|      46|      12|      26|       4
---------------------------------------------------------------------------
   12-   26 (17.88/18.11)	GAKGPLGghgrPARP
   60-   70 (23.34/11.16)	GALGPIG....PSSP
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP18897 with Med25 domain of Kingdom Metazoa

Unable to open file!