<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18878
Description |
Mediator complex subunit 25 |
Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPASLHHLQPPGAPSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
Length | 211 |
Position | Unknown |
Organism | Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Colobinae> Rhinopithecus.
|
Aromaticity | 0.09 |
Grand average of hydropathy | -0.001 |
Instability index | 55.73 |
Isoelectric point | 4.66 |
Molecular weight | 22498.46 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP18878
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 66.59| 13| 110| 39| 51| 1
---------------------------------------------------------------------------
39- 51 (25.99/14.71) YLLPA.IEYFN..GGP
151- 166 (16.22/ 6.42) YLLPAsLHHLQppGAP
176- 188 (24.38/13.34) APLPG.QMLLS..GGP
---------------------------------------------------------------------------
|