<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18877
| Description |
Mediator complex subunit 25 |
| Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYCPAPPRCPPRPSWNSFWPTPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPSWPAQLPPRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
| Length | 157 |
| Position | Unknown |
| Organism | Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Colobinae> Rhinopithecus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.265 |
| Instability index | 78.36 |
| Isoelectric point | 6.82 |
| Molecular weight | 16654.13 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18877
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 116.43| 32| 46| 54| 98| 1
---------------------------------------------------------------------------
54- 98 (61.23/25.64) PP.RPSWNSFWPtP....PGPILRPQNP.GanpqlrslllnpPPPQTGVPP
108- 145 (55.20/11.70) PPgAPSWPAQLP.PraplPGQMLLSGGPrG............PVPQPGLQP
---------------------------------------------------------------------------
|