<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18862

Description Mediator of RNA polymerase II transcription subunit 15
SequenceMDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHNKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIPVVQQQQQQLQQQQQQQQHLIKLHHQNQQQVPGLLFLLLASLLQCEPWPPMQQPQPPPTQALPQQLQQMHHPQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVSTCGPQWSTCSPWLCQQYAPAEPLHFQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPGSQPNSNVRPALPGPWLTCFSHLSAAPALPHPPVASCPALHQLNGLTHLCPAVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKTLHTAHGGSTGAWIPTPHRPRWPRPNSGSSLCQPLLTPVLGPAHSFAAMTAIHGPTHPAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSVHQACLSAA
Length555
PositionTail
OrganismRhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Colobinae> Rhinopithecus.
Aromaticity0.05
Grand average of hydropathy-0.589
Instability index75.17
Isoelectric point8.83
Molecular weight61691.71
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364148

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP18862
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      96.47|      25|      27|     116|     142|       1
---------------------------------------------------------------------------
  111-  135 (52.85/16.40)	LLQCEPWPPMQQPQPPP.TQALPQQL
  138-  163 (43.62/ 8.60)	MHHPQHHQPPPQPQQPPvAQNQPSQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.52|      21|      25|     261|     284|       2
---------------------------------------------------------------------------
  253-  281 (31.55/ 8.89)	QPgqpgsqPNSNVR..PALpgPWLTCFSHLS
  283-  307 (28.96/ 6.28)	AP....alPHPPVAscPAL..HQLNGLTHLC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      60.06|      17|      18|     220|     236|       3
---------------------------------------------------------------------------
  184-  200 (28.63/ 9.05)	LYTQPPLKFVSTCGPQW
  220-  236 (31.42/10.71)	QVSQSSLPMLSSPSPGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      42.63|      11|      27|     513|     523|       5
---------------------------------------------------------------------------
  513-  523 (23.59/15.08)	NPFLQSVHR.CM
  541-  552 (19.03/10.66)	NTWAQSVHQaCL
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP18862 with Med15 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) FQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPGSQPNSNVRPA
2) PWPPMQQPQPPPTQALPQQLQQMHHPQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPG
3) RRMINKIDKNEDRKKDLSKMKTLHTAHGGSTGAWIPTPHRPRWPRPNSGSSL
219
116
344
268
181
395










Molecular Recognition Features






MoRF SequenceStartStop




NANANA