<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18862
| Description |
Mediator of RNA polymerase II transcription subunit 15 |
| Sequence | MDVSGQETDWRSTAFRQKLVSQIEDAMRKAGVAHNKSSKDMESHVFLKAKTRDEYLSLVARLIIHFRDIPVVQQQQQQLQQQQQQQQHLIKLHHQNQQQVPGLLFLLLASLLQCEPWPPMQQPQPPPTQALPQQLQQMHHPQHHQPPPQPQQPPVAQNQPSQLPPQSQTQPLVSQAQALPGQMLYTQPPLKFVSTCGPQWSTCSPWLCQQYAPAEPLHFQVSQSSLPMLSSPSPGQQVQTPQSMPPPPQPSPQPGQPGSQPNSNVRPALPGPWLTCFSHLSAAPALPHPPVASCPALHQLNGLTHLCPAVNPSSVMSPAGSSQAEEQQYLDKLKQLSKYIEPLRRMINKIDKNEDRKKDLSKMKTLHTAHGGSTGAWIPTPHRPRWPRPNSGSSLCQPLLTPVLGPAHSFAAMTAIHGPTHPAPVVCTRKRRLEDDERQSIPSVLQGEVARLDPKFLVNLDPSHCSNNGTVHLICKLDDKDLPSVPPLELSVPADYPAQSPLWIDRQWQYDANPFLQSVHRCMTSRLLQLPDKHSVTALLNTWAQSVHQACLSAA |
| Length | 555 |
| Position | Tail |
| Organism | Rhinopithecus bieti (Black snub-nosed monkey) (Pygathrix bieti) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini>
Cercopithecidae> Colobinae> Rhinopithecus.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.589 |
| Instability index | 75.17 |
| Isoelectric point | 8.83 |
| Molecular weight | 61691.71 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP18862
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 96.47| 25| 27| 116| 142| 1
---------------------------------------------------------------------------
111- 135 (52.85/16.40) LLQCEPWPPMQQPQPPP.TQALPQQL
138- 163 (43.62/ 8.60) MHHPQHHQPPPQPQQPPvAQNQPSQL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.52| 21| 25| 261| 284| 2
---------------------------------------------------------------------------
253- 281 (31.55/ 8.89) QPgqpgsqPNSNVR..PALpgPWLTCFSHLS
283- 307 (28.96/ 6.28) AP....alPHPPVAscPAL..HQLNGLTHLC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.06| 17| 18| 220| 236| 3
---------------------------------------------------------------------------
184- 200 (28.63/ 9.05) LYTQPPLKFVSTCGPQW
220- 236 (31.42/10.71) QVSQSSLPMLSSPSPGQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.63| 11| 27| 513| 523| 5
---------------------------------------------------------------------------
513- 523 (23.59/15.08) NPFLQSVHR.CM
541- 552 (19.03/10.66) NTWAQSVHQaCL
---------------------------------------------------------------------------
|