<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18845
| Description |
Cyclin dependent kinase 19 |
| Sequence | MSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYVEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDEPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGAGAGLQHSQDSGLSQVPPSKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSSQYHSSHQAHRY |
| Length | 398 |
| Position | Kinase |
| Organism | Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lemuriformes>
Indriidae> Propithecus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.723 |
| Instability index | 61.05 |
| Isoelectric point | 8.68 |
| Molecular weight | 44770.92 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18845
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 88.45| 17| 32| 306| 322| 1
---------------------------------------------------------------------------
282- 298 (30.25/13.36) PQQAAAPPQ..APPPQQNS
306- 322 (29.96/13.16) GGAGAGVGG..AGAGLQHS
339- 357 (28.24/12.03) GPSGANSGGpvMPSDYQHS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.73| 15| 15| 361| 375| 2
---------------------------------------------------------------------------
361- 375 (27.81/15.54) LNYQSSVQGSSQSQS
377- 391 (28.92/16.43) LGYSSSSQQSSQYHS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.65| 16| 17| 215| 230| 7
---------------------------------------------------------------------------
215- 230 (27.33/14.89) DPTKRITSEQALQDPY
234- 249 (29.32/16.45) DPLPTLDVFAGCQIPY
---------------------------------------------------------------------------
|