<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18843
| Description |
Cyclin dependent kinase 19 |
| Sequence | MCRKDEKEYALKQIEGTGISMSACREIALLRELKHPNVIALQKVFLSHSDRKVWLLFDYAEHDLWHIIKFHRASKANKKPMQLPRSMVKSLLYQILDGIHYLHANWVLHRDLKPANILVMGEGPERGRVKIADMGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIDIWAIGCIFAELLTSEPIFHCRQEDIKTSNPFHHDQLDRIFSVMGFPADKDWEDIRKMPEYPTLQKDFRRTTYANSSLIKYVEKHKVKPDSKVFLLLQKLLTMDPTKRITSEQALQDPYFQEDPLPTLDVFAGCQIPYPKREFLNEDEPEEKGDKNQQQQQNQHQQPTAPPQQAAAPPQAPPPQQNSTQTNGTAGGAGAGVGGAGAGLQHSQDSGLSQVPPSKKPRLGPSGANSGGPVMPSDYQHSSSRLNYQSSVQGSSQSQSTLGYSSSSQQSSQYHSSHQAHRY |
| Length | 462 |
| Position | Kinase |
| Organism | Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lemuriformes>
Indriidae> Propithecus.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.641 |
| Instability index | 57.38 |
| Isoelectric point | 8.72 |
| Molecular weight | 52009.29 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18843
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.65| 16| 17| 279| 294| 1
---------------------------------------------------------------------------
279- 294 (27.33/16.19) DPTKRITSEQALQDPY
298- 313 (29.32/17.90) DPLPTLDVFAGCQIPY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.02| 24| 41| 348| 371| 2
---------------------------------------------------------------------------
335- 352 (24.77/ 9.83) ......QQNQHQQPTAPPQQAAAP
353- 376 (42.95/22.54) PQAPPPQQNSTQTNGTAGGAGAGV
392- 410 (24.30/ 9.50) SQVPPSKKPRLGPSGANSG.....
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 84.13| 28| 40| 147| 186| 4
---------------------------------------------------------------------------
111- 138 (48.25/29.01) DLKPANILVMGEGPE.....RGRVKIADM...G..FAR
149- 186 (35.87/54.70) DLDPVVVTFWYRAPElllgaRHYTKAIDIwaiGciFAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 56.73| 15| 15| 425| 439| 5
---------------------------------------------------------------------------
425- 439 (27.81/17.03) LNYQSSVQGSSQSQS
441- 455 (28.92/17.99) LGYSSSSQQSSQYHS
---------------------------------------------------------------------------
|