<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18839
| Description |
TATA-box binding protein |
| Sequence | MDQNNSLPPYAQGLASPQGAMTPGIPIFSPMMPYGTGLTPQPIQNTSSLSILEEQQRQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQVAQQSTSQQAAQVASGQAPPLFHSQTLTTAPLPGTTPLYPSPLTPMTPITPATPASESSGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNMVGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAKVRAEIYEAFENIYPILKGFRKTT |
| Length | 335 |
| Position | Tail |
| Organism | Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lemuriformes>
Indriidae> Propithecus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.476 |
| Instability index | 65.29 |
| Isoelectric point | 9.80 |
| Molecular weight | 37348.35 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | cytoplasm GO:0005737 IEA:Ensembl
euchromatin GO:0000791 IEA:Ensembl
female pronucleus GO:0001939 IEA:Ensembl
male pronucleus GO:0001940 IEA:Ensembl
transcription factor TFIIA complex GO:0005672 IEA:Ensembl
transcription factor TFIID complex GO:0005669 IEA:Ensembl
transcription preinitiation complex GO:0097550 IEA:Ensembl
|
| GO - Biological Function | aryl hydrocarbon receptor binding GO:0017162 IEA:Ensembl
enzyme binding GO:0019899 IEA:Ensembl
RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IEA:Ensembl
RNA polymerase II core promoter sequence-specific DNA binding GO:0000979 IEA:Ensembl
RNA polymerase II general transcription initiation factor activity GO:0016251 IEA:Ensembl
RNA polymerase II repressing transcription factor binding GO:0001103 IEA:Ensembl
RNA polymerase III general transcription initiation factor activity GO:0000995 IEA:Ensembl
TFIIB-class transcription factor binding GO:0001093 IEA:Ensembl
|
| GO - Biological Process | RNA polymerase II preinitiation complex assembly GO:0051123 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP18839
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 100.12| 16| 16| 58| 73| 1
---------------------------------------------------------------------------
58- 73 (35.81/10.74) QQQQQQQQQQQQQQQQ
75- 89 (33.45/ 9.64) QQQQQQQQQQQQQQ.Q
90- 105 (30.87/ 8.43) QQQQQQQVAQQSTSQQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 213.35| 62| 88| 160| 221| 2
---------------------------------------------------------------------------
160- 221 (107.88/68.28) QLQNIVSTVNLGCKLDLKTIALRARN.AEYNPKRFAAVIMRIREPRTTALIFSSGKMVCTGAK
250- 312 (105.47/66.62) KIQNMVGSCDVKFPIRLEGLVLTHQQfSSYEPELFPGLIYRMIKPRIVLLIFVSGKVVLTGAK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.33| 15| 16| 123| 137| 3
---------------------------------------------------------------------------
123- 137 (28.75/16.30) LT.TAPLPGTTPLYPS
139- 154 (22.58/11.27) LTpMTPITPATPASES
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.08| 19| 21| 9| 28| 4
---------------------------------------------------------------------------
9- 28 (33.55/18.13) PYAQGLaSPQG.AMTPGIPIF
33- 52 (31.52/13.22) PYGTGL.TPQPiQNTSSLSIL
---------------------------------------------------------------------------
|