Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MAAMDIQDNLLGNSWVDSSWIPILNSGSILDYFSERSKPFYDRTCNNEVVKMQRLTLELLNQMVEVEYILLHAQEPILFIISKQQQQCPAQVIPLADYYIIAGVIYQAPDLGSVINSRKKLAGHGGASAFDEAMSWCRYHPSKGYWWHFKDDEDQKEEEPNFREKFPSKFVQQKSEEKPVPVDQTKKEAEPIPETVKSEDMETTKNVQQTALKPPKELGLQA |
Length | 222 |
Position | Head |
Organism | Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lemuriformes> Indriidae> Propithecus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.577 |
Instability index | 46.77 |
Isoelectric point | 5.03 |
Molecular weight | 25467.59 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP18822 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 91.56| 28| 34| 152| 179| 1 --------------------------------------------------------------------------- 152- 179 (49.55/34.00) DEDQKEEEP.....NFREKFPSKFVQQKSEEKP 183- 215 (42.01/27.82) DQTKKEAEPipetvKSEDMETTKNVQQTALKPP --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FREKFPSKFVQQKSEEKPVPVDQTKKEAEPIPETVKSEDMET 2) KNVQQTALKPPKELGL | 162 205 | 203 220 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab