<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18803
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MKIINARHRSSAGAERTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPAPTAATAPPGGDKSVAGCGPFYLMRELPGSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
| Length | 261 |
| Position | Head |
| Organism | Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lemuriformes>
Indriidae> Propithecus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.989 |
| Instability index | 63.97 |
| Isoelectric point | 9.96 |
| Molecular weight | 28143.91 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP18803
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 66.67| 16| 16| 207| 222| 2
---------------------------------------------------------------------------
189- 210 (22.18/ 7.87) KKKNKHKHKQSRtqdpvpPETP
211- 229 (20.31/ 6.69) SDSDHKKKKKKK...eedPERK
230- 247 (24.18/ 9.13) RKKKEKKKKKNR....hsPDHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 78.51| 17| 115| 131| 147| 4
---------------------------------------------------------------------------
85- 100 (23.21/10.58) .MRELPGSTELTGSTNL
131- 147 (31.86/16.76) GMIDLPGSHDNSSLRSL
248- 260 (23.44/10.75) GM....GSSQASSSSSL
---------------------------------------------------------------------------
|