Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MKIINARHRSSAGAERTMENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPAPTAATAPPGGDKSVAGCGPFYLMRELPGSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILGGSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDHPGMGSSQASSSSSLR |
Length | 261 |
Position | Head |
Organism | Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lemuriformes> Indriidae> Propithecus. |
Aromaticity | 0.04 |
Grand average of hydropathy | -0.989 |
Instability index | 63.97 |
Isoelectric point | 9.96 |
Molecular weight | 28143.91 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP18803 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 66.67| 16| 16| 207| 222| 2 --------------------------------------------------------------------------- 189- 210 (22.18/ 7.87) KKKNKHKHKQSRtqdpvpPETP 211- 229 (20.31/ 6.69) SDSDHKKKKKKK...eedPERK 230- 247 (24.18/ 9.13) RKKKEKKKKKNR....hsPDHP --------------------------------------------------------------------------- --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 3| 78.51| 17| 115| 131| 147| 4 --------------------------------------------------------------------------- 85- 100 (23.21/10.58) .MRELPGSTELTGSTNL 131- 147 (31.86/16.76) GMIDLPGSHDNSSLRSL 248- 260 (23.44/10.75) GM....GSSQASSSSSL --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) NFTALF 2) SDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPDH | 20 213 | 25 246 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab