<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18792
Description |
Uncharacterized protein |
Sequence | MAAPLGGMFSGQPPGPPPPPPGLPGQASLLQATPGAQRPSNSTLVDELESSFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKE |
Length | 113 |
Position | Head |
Organism | Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lemuriformes>
Indriidae> Propithecus.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.358 |
Instability index | 60.93 |
Isoelectric point | 4.60 |
Molecular weight | 12201.67 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP18792
No repeats found
No repeats found
|