<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18791

Description Transcription elongation factor A2
SequenceMMGKEEEIARIARRLDKMVTKKSAEGAMDLLRELKAMPVTLHLLQSTRVGMSVNALRKQSSDEEVIALAKSLIKSWKKLLDASDAKARERGRGTPLPTSSSKDASEAMDPRRRRPELPRTPPTPRMTTFPPVPVTCDAVRNKCREMLTAALQTDHDHVATGADCERLSAQIEEYILCAGLPGPGFLAESGGCPGPSLGGHLPGWSPAGVVTSLSQERPPWTAEGLIL
Length227
PositionUnknown
OrganismPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lemuriformes> Indriidae> Propithecus.
Aromaticity0.03
Grand average of hydropathy-0.396
Instability index64.34
Isoelectric point8.85
Molecular weight24585.12
Publications

Function

Annotated function
GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell
GO - Biological Function
GO - Biological Process
transcription, DNA-templated	GO:0006351	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP18791
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.38|      13|      14|     196|     208|       1
---------------------------------------------------------------------------
  196-  208 (26.80/13.74)	SLGGHLPGWSPAG
  212-  224 (25.58/12.84)	SLSQERPPWTAEG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP18791 with Med26 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) DAKARERGRGTPLPTSSSKDASEAMDPRRRRPELPRTPPTPRMTTFPPVPV
84
134

Molecular Recognition Features

MoRF SequenceStartStop
NANANA