<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18786

Description Mediator complex subunit 14
SequenceMAPVQLENHQLVPPGGGGGGSGGPASAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLHRAYSELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKIEKQATLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVHSMQINFIHQLVQSRLFADEKPLQDMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVERYHAGKCLSLLVWNQQILGRKTGTASVHKVTIKIDENDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARAHQKLQELKAILRGFNANENSSIETALPALVVPILEPCGNSECLHIFVDLHSGMFQLTLYGLDQATLDDMEKSVNDDMKRIIPWIQQLKFWLGQQRCKQSIKHLPTISSETLQLSNYSTHPIGNLSKNKLFIKLTRLPQYYIVVEMLEVPNKPTQLSYQYYFMSVNAGDRDDSPVMALLLQQFKEDVQDMVFRTKSGKQTRNSTKRKLSDDPCPVESKKTKRSGEMCAFNKVLAHFVAMCDTNMPFVGLRLELSNLEIPHQGVQVEGDGFSHAIRLLKIPPCKGVNEETQKALDRSLLDCTFRLQGRNNRTWVAELVFANCPLNGTSTREQGPSRHVYLTYENLLSEPVGGRKVVEMFLNDWNSIARLYECVLEFARSLPDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSIHQKFHISLGTVGPNSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQSSTHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKLVEGFYPAPGLKTFLNMFVDSNQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPPPQQQPFSKQPGTSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPHGTLDPSSPYTMVSPSGRAGNWPGSPQVSGPSPATRMPGMSPANPSLHSPVPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSPTPGLVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQTLQLKVTPENAGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLEL
Length1324
PositionTail
OrganismPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lemuriformes> Indriidae> Propithecus.
Aromaticity0.07
Grand average of hydropathy-0.211
Instability index51.29
Isoelectric point8.85
Molecular weight146550.16
Publications

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
GO - Cellular Component
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
transcription coactivator activity	GO:0003713	IEA:Ensembl
GO - Biological Process
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IEA:Ensembl

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP18786
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             4|     311.32|      62|      64|    1002|    1063|       1
---------------------------------------------------------------------------
   13-   48 (46.69/17.33)	...............................PPGGGGGGSGGPASAPAPP.....P..PGAAV....AAAAAAAASPG.................
 1002- 1060 (107.49/49.68)	...............................PPPQQQPFSKQPGTSGAYPL.TSPPTSYHSTVN..QSPSMMHTQSPGNLHAA..SSPSGALRAP
 1061- 1125 (104.39/48.03)	SPA.......................sfvptPPPSSHGISIGPGASFASPHgTLDPSSPYTMV....SPSGRAGNWPGS.PQV..SGPSPATRMP
 1128- 1206 (52.76/20.56)	SPAnpslhspvpdashspragtssqtmptnmPPPR.....KLPQRSWAASI...PTILTHSALNilLLPSPTPGLVPG.LAGSylCSP.......
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      94.64|      30|      32|     246|     275|       2
---------------------------------------------------------------------------
  246-  275 (48.89/37.87)	RLLKLEILVEDKETGDGRALVH....SMQINFIH
  276-  309 (45.75/34.88)	QLVQSRLFADEKPLQDMYNCLHsfclSLQLEVLH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      82.64|      26|      32|     511|     540|       5
---------------------------------------------------------------------------
  511-  540 (39.31/31.90)	HLPT..ISSETLQLSNYSTHpignLSKNKLFI
  544-  571 (43.33/24.51)	RLPQyyIVVEMLEVPNKPTQ....LSYQYYFM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.27|      32|      32|      66|      97|       6
---------------------------------------------------------------------------
   66-   97 (51.36/39.92)	LMVLTDLLPRKSDVERKIEIVQFASRTRQLFV
   99-  130 (52.92/41.38)	LLALVKWANNAGKVEKCAMISSFLDQQAILFV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.49|      14|      29|     168|     181|       7
---------------------------------------------------------------------------
  168-  181 (26.30/13.24)	RLPTCIRDKII....PPD
  194-  211 (19.19/ 7.70)	QLNQILRHRLVttdlPPQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.75|      12|      34|     359|     370|      10
---------------------------------------------------------------------------
  359-  370 (20.47/13.20)	IKIDENDVSKPL
  390-  401 (20.28/13.01)	MKIDHLSIEKLL
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP18786 with Med14 domain of Kingdom Metazoa

Unable to open file!