<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18781
| Description |
Mediator of RNA polymerase II transcription subunit 16 |
| Sequence | MSLLFRLLTKLWICCRDEGPASEPDEALVDECCLLPSQLLIPSLDWLPVSDGLVSRLQPKQPLRLHFGKAPTLPGSATSLQLDGLIRAPGQPRIDHLRRLHLGAYPTEECKACARCGCVTMLKSPNRTTAVKQWEQRWIKNCLCGGLWRRVPLSYP |
| Length | 156 |
| Position | Tail |
| Organism | Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lemuriformes>
Indriidae> Propithecus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.147 |
| Instability index | 72.03 |
| Isoelectric point | 8.89 |
| Molecular weight | 17498.41 |
| Publications | |
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18781
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 102.98| 22| 32| 51| 72| 1
---------------------------------------------------------------------------
26- 49 (30.99/11.96) EALVDEccLLPSQL....L.IPSLDWLPV
51- 72 (42.47/18.22) DGLVSR..LQPKQP....L.RLHFGKAPT
83- 107 (29.52/11.16) DGLI.R...APGQPridhLrRLHLGAYPT
---------------------------------------------------------------------------
|