<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18778
| Description |
Mediator complex subunit 25 |
| Sequence | MVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGAPQGPPGAAPGQPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPSRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI |
| Length | 180 |
| Position | Unknown |
| Organism | Propithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lemuriformes>
Indriidae> Propithecus.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.245 |
| Instability index | 79.26 |
| Isoelectric point | 6.16 |
| Molecular weight | 18563.23 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP18778
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.25| 20| 23| 125| 146| 2
---------------------------------------------------------------------------
125- 146 (37.42/11.22) GPPLLHPPPAQSWPAqlPSRAP
149- 168 (36.82/ 7.44) GQMLLSGGPRGPVPQ..PGLQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.37| 16| 30| 54| 69| 4
---------------------------------------------------------------------------
54- 69 (34.05/ 8.84) PPGAAPGQPPPGPILR
86- 101 (34.32/ 8.97) PPPPQTGVPPPQASLH
---------------------------------------------------------------------------
|