<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP18772

Description Mediator complex subunit 25
SequenceMVPGSEGPARAGGLVADVVFVIEGTANLGPYFEGLRKHYLLPAIEYFNGGPPAETDFGGDYGGTQYSLVVFNTVDCAPESYVQCHAPTSSAYEFVTWLDGIKFMGGGGESCSLIAEGLSTALQLFDDFKKMREQIGQTHRVCLLICNSPPYLLPAVESTTYSGYTTESLVQKIGERGIHFSIVSPRKLPALRLLFEKAAPPALLEPLQPPADVSQDPRHMVLVRGLVLPVGGGSASGPLQPKQPVPLPPTAPSGATLSAAPQQPLPPVPPQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPITPLQQAAPGVGAPFSQASAPPLPPGPPGAPKPPPASQPSLVSTVAPGPGLAPSAQPGAPSMAGTVAPGGVSGPSPAQLGAPALGGQQSVSNKLLAWSGVLEWQEKPKPASVDANTKLTRSLPCQVYVNHGENLKTEQWPQKLIMQLIPQQLLTTLGPLFRNSRMVQFHFTNKDLESLKGLYRIMGNGFAGCVHFPHTAPCEVRVLMLLYSSKKKIFMGLIPYDQSGFVNGIRQVITNHKQVQQQKLEQQRGMGGQQAPPGLGPILEDQARPSQNLLQLRPPQPQPQGTVGASGATGQPQPQGTTQAPPGAPQGPPGAAPGQPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPSRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMDLI
Length746
PositionUnknown
OrganismPropithecus coquereli (Coquerel's sifaka) (Propithecus verreauxi coquereli)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Strepsirrhini> Lemuriformes> Indriidae> Propithecus.
Aromaticity0.05
Grand average of hydropathy-0.241
Instability index58.89
Isoelectric point8.76
Molecular weight78022.64
Publications









Function






Annotated function


GO - Cellular Component
nucleus	GO:0005634	IEA:UniProtKB-SubCell

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP18772
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             5|     212.98|      29|      30|     185|     213|       4
---------------------------------------------------------------------------
  185-  213 (51.19/13.74)	PRKLPALR................LLFEKAAP...PAL....LEPLQPPADV
  217-  245 (38.69/ 8.12)	PRHMVLVR................GLVLPVGG...GSA....SGPLQPKQPV
  248-  274 (45.46/11.16)	PPTAPSGA................TL..SAAP...QQP....LPPVPPQYQV
  628-  659 (38.79/ 8.16)	PPPGPILR....................PQNPganPQLrsllLNPPPPQTGV
  660-  703 (38.85/ 8.19)	PPPQASLHhlqppgapallppphqGLGQPQLG...PPL....LHP.PPAQSW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.55|      21|      40|     546|     566|       7
---------------------------------------------------------------------------
  546-  566 (40.11/15.73)	QVQQQKLEQQRGMGGQQAPPG
  588-  608 (38.44/14.75)	QPQPQGTVGASGATGQPQPQG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.27|      30|     111|      39|      69|       8
---------------------------------------------------------------------------
   39-   69 (53.43/34.15)	YLLPAIEYFN.GGPPAETdFGGDYG..GTQYSLV
  151-  183 (43.84/23.04)	YLLPAVESTTySGYTTES.LVQKIGerGIHFSIV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.62|      22|      25|     464|     487|       9
---------------------------------------------------------------------------
  464-  487 (34.11/34.49)	LFrnSRMVQF.HFTNKDLESLKGLY
  493-  515 (37.50/29.34)	GF..AGCVHFpHTAPCEVRVLMLLY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.71|      15|      24|     422|     436|      11
---------------------------------------------------------------------------
  422-  436 (28.29/19.52)	KLTRSL.PCQVYVNHG
  447-  462 (21.42/12.64)	KLIMQLiPQQLLTTLG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      70.34|      16|     321|     381|     396|      12
---------------------------------------------------------------------------
  372-  385 (19.96/ 6.22)	..APGGVSGPSPAQLG
  386-  401 (24.64/ 9.58)	APALGGQQSVSNKLLA
  403-  418 (25.73/10.37)	SGVLEWQEKPKPASVD
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP18772 with Med25 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) GSASGPLQPKQPVPLPPTAPSGATLSAAPQQPLPPVPPQYQVPGNLSAAQVAAQNAVEAAKNQKAGLGPRFSPITPLQQAAPGVGAPFSQASAPPLPPGPPGAPKPPPASQPSLVSTVAPGPGLAPSAQPGAPSMAGTVAPGGVSGPSPAQLGAPALG
2) HKQVQQQKLEQQRGMGGQQAPPGLGPILEDQARPSQNLLQLRPPQPQPQGTVGASGATGQPQPQGTTQAPPGAPQGPPGAAPGQPPPGPILRPQNPGANPQLRSLLLNPPPPQTGVPPPQASLHHLQPPGAPALLPPPHQGLGQPQLGPPLLHPPPAQSWPAQLPSRAPLPGQMLLSGGPRGPVPQPGLQPSVMEDDILMD
233
544
390
744










Molecular Recognition Features






MoRF SequenceStartStop




NANANA